Lineage for d1kzha_ (1kzh A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 185977Fold c.89: Phosphofructokinase [53783] (1 superfamily)
  4. 185978Superfamily c.89.1: Phosphofructokinase [53784] (1 family) (S)
  5. 185979Family c.89.1.1: Phosphofructokinase [53785] (2 proteins)
  6. 185995Protein Pyrophosphate-dependent phosphofructokinase [75321] (1 species)
  7. 185996Species Lyme disease spirochete (Borrelia burgdorferi) [TaxId:139] [75322] (1 PDB entry)
  8. 185997Domain d1kzha_: 1kzh A: [73361]

Details for d1kzha_

PDB Entry: 1kzh (more details), 2.55 Å

PDB Description: structure of a pyrophosphate-dependent phosphofructokinase from the lyme disease spirochete borrelia burgdorferi

SCOP Domain Sequences for d1kzha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kzha_ c.89.1.1 (A:) Pyrophosphate-dependent phosphofructokinase {Lyme disease spirochete (Borrelia burgdorferi)}
slfkqerqkyipklpnilkkdfnnislvygenteaiqdrqalkeffkntyglpiisfteg
esslsfskalnigiilsggpapgghnvisgvfdaikkfnpnsklfgfkggplgllendki
elteslinsyrntggfdivssgrtkieteehynkalfvakennlnaiiiiggddsntnaa
ilaeyfkkngeniqvigvpktidadlrndhieisfgfdsatkiyselignlcrdamstkk
ywhfvklmgrsashvalecalkthpnicivseevlakkktlseiidemvsvilkrslngd
nfgvvivpegliefipevkslmlelcdifdknegefkglniekmkeifvaklsdymkgvy
lslplfiqfeliksilerdphgnfnvsrvpteklfiemiqsrlndmkkrgeykgsftpvd
hffgyegrsafpsnfdsdycyslgynavvlilngltgymsciknlnlkptdwiaggvplt
mlmnmeerygekkpvikkalvdlegrpfkefvknrdkwalnnlylypgpvqyfgsseivd
eitetlklel

SCOP Domain Coordinates for d1kzha_:

Click to download the PDB-style file with coordinates for d1kzha_.
(The format of our PDB-style files is described here.)

Timeline for d1kzha_: