Lineage for d1kzha_ (1kzh A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142778Fold c.89: Phosphofructokinase [53783] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has mixed sheet of 7 strands, order 3214567; strands 3 & 7 are antiparallel to the rest
    Domain 2 has parallel sheet of 4 strands, order 2314
  4. 2142779Superfamily c.89.1: Phosphofructokinase [53784] (2 families) (S)
  5. 2142780Family c.89.1.1: Phosphofructokinase [53785] (3 protein domains)
  6. 2142820Protein Pyrophosphate-dependent phosphofructokinase [75321] (1 species)
  7. 2142821Species Lyme disease spirochete (Borrelia burgdorferi) [TaxId:139] [75322] (1 PDB entry)
  8. 2142822Domain d1kzha_: 1kzh A: [73361]
    complexed with so4

Details for d1kzha_

PDB Entry: 1kzh (more details), 2.55 Å

PDB Description: structure of a pyrophosphate-dependent phosphofructokinase from the lyme disease spirochete borrelia burgdorferi
PDB Compounds: (A:) phosphofructokinase

SCOPe Domain Sequences for d1kzha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kzha_ c.89.1.1 (A:) Pyrophosphate-dependent phosphofructokinase {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}
slfkqerqkyipklpnilkkdfnnislvygenteaiqdrqalkeffkntyglpiisfteg
esslsfskalnigiilsggpapgghnvisgvfdaikkfnpnsklfgfkggplgllendki
elteslinsyrntggfdivssgrtkieteehynkalfvakennlnaiiiiggddsntnaa
ilaeyfkkngeniqvigvpktidadlrndhieisfgfdsatkiyselignlcrdamstkk
ywhfvklmgrsashvalecalkthpnicivseevlakkktlseiidemvsvilkrslngd
nfgvvivpegliefipevkslmlelcdifdknegefkglniekmkeifvaklsdymkgvy
lslplfiqfeliksilerdphgnfnvsrvpteklfiemiqsrlndmkkrgeykgsftpvd
hffgyegrsafpsnfdsdycyslgynavvlilngltgymsciknlnlkptdwiaggvplt
mlmnmeerygekkpvikkalvdlegrpfkefvknrdkwalnnlylypgpvqyfgsseivd
eitetlklel

SCOPe Domain Coordinates for d1kzha_:

Click to download the PDB-style file with coordinates for d1kzha_.
(The format of our PDB-style files is described here.)

Timeline for d1kzha_: