Lineage for d1kzgd_ (1kzg D:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483669Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 483670Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 484126Family c.37.1.8: G proteins [52592] (43 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 484167Protein CDC42 [52619] (1 species)
  7. 484168Species Human (Homo sapiens) [TaxId:9606] [52620] (16 PDB entries)
  8. 484180Domain d1kzgd_: 1kzg D: [73360]
    Other proteins in same PDB: d1kzga1, d1kzga2, d1kzgc1, d1kzgc2

Details for d1kzgd_

PDB Entry: 1kzg (more details), 2.6 Å

PDB Description: dbscdc42(y889f)

SCOP Domain Sequences for d1kzgd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kzgd_ c.37.1.8 (D:) CDC42 {Human (Homo sapiens)}
mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaal

SCOP Domain Coordinates for d1kzgd_:

Click to download the PDB-style file with coordinates for d1kzgd_.
(The format of our PDB-style files is described here.)

Timeline for d1kzgd_: