Lineage for d1kzgd_ (1kzg D:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. Protein CDC42 [52619] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [52620] (34 PDB entries)
  8. Domain d1kzgd_: 1kzg D: [73360]
    Other proteins in same PDB: d1kzga1, d1kzga2, d1kzgc1, d1kzgc2

Details for d1kzgd_

PDB Entry: 1kzg (more details), 2.6 Å

PDB Description: DbsCdc42(Y889F)
PDB Compounds: (D:) cdc42 homolog

SCOPe Domain Sequences for d1kzgd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kzgd_ c.37.1.8 (D:) CDC42 {Human (Homo sapiens) [TaxId: 9606]}
mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaal

SCOPe Domain Coordinates for d1kzgd_ are not available.

Timeline for d1kzgd_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1kzga1, d1kzga2, d1kzgb_, d1kzgc1, d1kzgc2