Lineage for d1kzgc2 (1kzg C:1819-1960)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 672997Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 672998Superfamily b.55.1: PH domain-like [50729] (12 families) (S)
  5. 672999Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (43 proteins)
    Pfam PF00169
  6. 673040Protein Dbl's big sister, Dbs [74989] (1 species)
  7. 673041Species Mouse (Mus musculus) [TaxId:10090] [74990] (4 PDB entries)
  8. 673045Domain d1kzgc2: 1kzg C:1819-1960 [73359]
    Other proteins in same PDB: d1kzga1, d1kzgb_, d1kzgc1, d1kzgd_
    mutant

Details for d1kzgc2

PDB Entry: 1kzg (more details), 2.6 Å

PDB Description: dbscdc42(y889f)
PDB Compounds: (C:) guanine nucleotide exchange factor dbs

SCOP Domain Sequences for d1kzgc2:

Sequence, based on SEQRES records: (download)

>d1kzgc2 b.55.1.1 (C:1819-1960) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]}
tgydgnlgdlgkllmqgsfsvwtdhkkghtkvkelarfkpmqrhlflhekavlfckkree
ngegyekapsfsykqslnmtavgitenvkgdtkkfeiwynareevyiiqaptpeikaawv
neirkvltsqlqacreasqhra

Sequence, based on observed residues (ATOM records): (download)

>d1kzgc2 b.55.1.1 (C:1819-1960) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]}
tgydgnlgdlgkllmqgsfsvwtdhkelarfkpmqrhlflhekavlfckkreengegyek
apsfsykqslnmtavgitenvkgdtkkfeiwynareevyiiqaptpeikaawvneirkvl
tsqlqacreasqhra

SCOP Domain Coordinates for d1kzgc2:

Click to download the PDB-style file with coordinates for d1kzgc2.
(The format of our PDB-style files is described here.)

Timeline for d1kzgc2: