Lineage for d1kzgc2 (1kzg C:1819-1960)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 300574Fold b.55: PH domain-like [50728] (1 superfamily)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 300575Superfamily b.55.1: PH domain-like [50729] (6 families) (S)
  5. 300576Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (15 proteins)
  6. 300591Protein Dbl's big sister, Dbs [74989] (1 species)
  7. 300592Species Mouse (Mus musculus) [TaxId:10090] [74990] (3 PDB entries)
  8. 300600Domain d1kzgc2: 1kzg C:1819-1960 [73359]
    Other proteins in same PDB: d1kzga1, d1kzgb_, d1kzgc1, d1kzgd_
    mutant

Details for d1kzgc2

PDB Entry: 1kzg (more details), 2.6 Å

PDB Description: dbscdc42(y889f)

SCOP Domain Sequences for d1kzgc2:

Sequence, based on SEQRES records: (download)

>d1kzgc2 b.55.1.1 (C:1819-1960) Dbl's big sister, Dbs {Mouse (Mus musculus)}
tgydgnlgdlgkllmqgsfsvwtdhkkghtkvkelarfkpmqrhlflhekavlfckkree
ngegyekapsfsykqslnmtavgitenvkgdtkkfeiwynareevyiiqaptpeikaawv
neirkvltsqlqacreasqhra

Sequence, based on observed residues (ATOM records): (download)

>d1kzgc2 b.55.1.1 (C:1819-1960) Dbl's big sister, Dbs {Mouse (Mus musculus)}
tgydgnlgdlgkllmqgsfsvwtdhkelarfkpmqrhlflhekavlfckkreengegyek
apsfsykqslnmtavgitenvkgdtkkfeiwynareevyiiqaptpeikaawvneirkvl
tsqlqacreasqhra

SCOP Domain Coordinates for d1kzgc2:

Click to download the PDB-style file with coordinates for d1kzgc2.
(The format of our PDB-style files is described here.)

Timeline for d1kzgc2: