Lineage for d1kzgc1 (1kzg C:1624-1818)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
    multihelical; core: 5-helical bundle
  4. Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (2 families) (S)
    automatically mapped to Pfam PF00621
  5. Family a.87.1.1: DBL homology domain (DH-domain) [48066] (10 proteins)
    Pfam PF00621
  6. Protein Dbl's big sister, Dbs [74743] (1 species)
  7. Species Mouse (Mus musculus) [TaxId:10090] [74744] (4 PDB entries)
    Uniprot Q64096 624-958 # 98% sequence identity; the rat sequence Q63406 region 499-833 is 100% identical to the PDB sequence
  8. Domain d1kzgc1: 1kzg C:1624-1818 [73358]
    Other proteins in same PDB: d1kzga2, d1kzgb_, d1kzgc2, d1kzgd_

Details for d1kzgc1

PDB Entry: 1kzg (more details), 2.6 Å

PDB Description: DbsCdc42(Y889F)
PDB Compounds: (C:) guanine nucleotide exchange factor dbs

SCOPe Domain Sequences for d1kzgc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kzgc1 a.87.1.1 (C:1624-1818) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]}
eeeeslailrrhvmnelldterayveellcvlegyaaemdnplmahlistglqnkknilf
gnmeeiyhfhnriflrelescidcpelvgrcflermeefqiyekycqnkprseslwrqcs
dcpffqecqkkldhklsldsyllkpvqritkyqlllkemlkyskhcegaedlqealssil
gilkavndsmhliai

SCOPe Domain Coordinates for d1kzgc1 are not available.

Timeline for d1kzgc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kzgc2
View in 3D
Domains from other chains:
(mouse over for more information)
d1kzga1, d1kzga2, d1kzgb_, d1kzgd_