Lineage for d1kzgb_ (1kzg B:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 313180Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 313181Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families) (S)
    division into families based on beta-sheet topologies
  5. 313510Family c.37.1.8: G proteins [52592] (35 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 313537Protein CDC42 [52619] (1 species)
  7. 313538Species Human (Homo sapiens) [TaxId:9606] [52620] (16 PDB entries)
  8. 313552Domain d1kzgb_: 1kzg B: [73357]
    Other proteins in same PDB: d1kzga1, d1kzga2, d1kzgc1, d1kzgc2

Details for d1kzgb_

PDB Entry: 1kzg (more details), 2.6 Å

PDB Description: dbscdc42(y889f)

SCOP Domain Sequences for d1kzgb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kzgb_ c.37.1.8 (B:) CDC42 {Human (Homo sapiens)}
mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepp
epkksrrs

SCOP Domain Coordinates for d1kzgb_:

Click to download the PDB-style file with coordinates for d1kzgb_.
(The format of our PDB-style files is described here.)

Timeline for d1kzgb_: