Lineage for d1kzga2 (1kzg A:819-965)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 805150Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 805151Superfamily b.55.1: PH domain-like [50729] (13 families) (S)
  5. 805152Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (47 proteins)
    Pfam PF00169
  6. 805197Protein Dbl's big sister, Dbs [74989] (1 species)
  7. 805198Species Mouse (Mus musculus) [TaxId:10090] [74990] (4 PDB entries)
    SQ Q64096 624-958 # 98% sequence identity; the rat sequence Q63406 region 499-833 is 100% identical to the PDB sequence
  8. 805201Domain d1kzga2: 1kzg A:819-965 [73356]
    Other proteins in same PDB: d1kzga1, d1kzgb_, d1kzgc1, d1kzgd_

Details for d1kzga2

PDB Entry: 1kzg (more details), 2.6 Å

PDB Description: dbscdc42(y889f)
PDB Compounds: (A:) guanine nucleotide exchange factor dbs

SCOP Domain Sequences for d1kzga2:

Sequence, based on SEQRES records: (download)

>d1kzga2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]}
tgydgnlgdlgkllmqgsfsvwtdhkkghtkvkelarfkpmqrhlflhekavlfckkree
ngegyekapsfsykqslnmtavgitenvkgdtkkfeiwynareevyiiqaptpeikaawv
neirkvltsqlqacreasqhraleqsh

Sequence, based on observed residues (ATOM records): (download)

>d1kzga2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]}
tgydgnlgdlgkllmqgsfsvwtdhkkgelarfkpmqrhlflhekavlfckkreengegy
ekapsfsykqslnmtavgitenvkgdtkkfeiwynareevyiiqaptpeikaawvneirk
vltsqlqacreasqhraleqsh

SCOP Domain Coordinates for d1kzga2:

Click to download the PDB-style file with coordinates for d1kzga2.
(The format of our PDB-style files is described here.)

Timeline for d1kzga2: