Lineage for d1kzga1 (1kzg A:624-818)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 644754Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
    multihelical; core: 5-helical bundle
  4. 644755Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (1 family) (S)
  5. 644756Family a.87.1.1: DBL homology domain (DH-domain) [48066] (9 proteins)
    Pfam PF00621
  6. 644760Protein Dbl's big sister, Dbs [74743] (1 species)
  7. 644761Species Mouse (Mus musculus) [TaxId:10090] [74744] (4 PDB entries)
  8. 644764Domain d1kzga1: 1kzg A:624-818 [73355]
    Other proteins in same PDB: d1kzga2, d1kzgb_, d1kzgc2, d1kzgd_

Details for d1kzga1

PDB Entry: 1kzg (more details), 2.6 Å

PDB Description: dbscdc42(y889f)
PDB Compounds: (A:) guanine nucleotide exchange factor dbs

SCOP Domain Sequences for d1kzga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kzga1 a.87.1.1 (A:624-818) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]}
eeeeslailrrhvmnelldterayveellcvlegyaaemdnplmahlistglqnkknilf
gnmeeiyhfhnriflrelescidcpelvgrcflermeefqiyekycqnkprseslwrqcs
dcpffqecqkkldhklsldsyllkpvqritkyqlllkemlkyskhcegaedlqealssil
gilkavndsmhliai

SCOP Domain Coordinates for d1kzga1:

Click to download the PDB-style file with coordinates for d1kzga1.
(The format of our PDB-style files is described here.)

Timeline for d1kzga1: