Lineage for d1kzfa_ (1kzf A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968867Family d.108.1.3: Autoinducer synthetase [75508] (2 proteins)
    Pfam PF00765
  6. 2968868Protein Acyl-homoserinelactone synthase EsaI [75509] (1 species)
  7. 2968869Species Pantoea stewartii subsp. stewartii [TaxId:66271] [75510] (2 PDB entries)
  8. 2968870Domain d1kzfa_: 1kzf A: [73354]

Details for d1kzfa_

PDB Entry: 1kzf (more details), 1.8 Å

PDB Description: Crystal Structure of the Acyl-homoserine Lactone Synthase, EsaI
PDB Compounds: (A:) acyl-homoserinelactone synthase EsaI

SCOPe Domain Sequences for d1kzfa_:

Sequence, based on SEQRES records: (download)

>d1kzfa_ d.108.1.3 (A:) Acyl-homoserinelactone synthase EsaI {Pantoea stewartii subsp. stewartii [TaxId: 66271]}
mlelfdvsyeelqttrseelyklrkktfsdrlgwevicsqgmesdefdgpgtryilgice
gqlvcsvrftsldrpnmithtfqhcfsdvtlpaygtessrffvdkararallgehypisq
vlflamvnwaqnnaygniytivsramlkiltrsgwqikvikeafltekeriylltlpagq
ddkqqlggdvvsrtgcppvavttwpltlpv

Sequence, based on observed residues (ATOM records): (download)

>d1kzfa_ d.108.1.3 (A:) Acyl-homoserinelactone synthase EsaI {Pantoea stewartii subsp. stewartii [TaxId: 66271]}
mlelfdvsyeelqttfsdrlgwevicsqgmesdefdgpgtryilgicegqlvcsvrftsl
drpnmithtfqhcfsdvtlpaygtessrffvdkararallgehypisqvlflamvnwaqn
naygniytivsramlkiltrsgwqikvikeafltekeriylltlpagqddkqqlggdvvs
rtgcppvavttwpltlpv

SCOPe Domain Coordinates for d1kzfa_:

Click to download the PDB-style file with coordinates for d1kzfa_.
(The format of our PDB-style files is described here.)

Timeline for d1kzfa_: