SCOPe 2.08: Domain d1kze1_: 1kze 1:

Lineage for d1kze1_ (1kze 1:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
   Pfam PF00059

6. Protein Mannose-binding protein A, C-lectin domain [56458] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)

8. Domain d1kze1_: 1kze 1: [73352]
   complexed with ca, cl, man

Details for d1kze1_

PDB Entry: 1kze, 1.8 Å

PDB Description: complex of mbp-c and bivalent man-terminated glycopeptide

PDB Compounds: (1:) mannose-binding protein c

SCOPe Domain Sequences for d1kze1_:

Sequence; same for both SEQRES and ATOM records:

>d1kze1_ d.169.1.1 (1:) Mannose-binding protein A, C-lectin domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgitdqrtenvfe
dltgnrvrytnwnegepnnvgsgencvvlltngkwndvpcsdsflvvcefs

Timeline for d1kze1_:

• d1kze1_ first appeared in SCOP 1.61
  
• d1kze1_ appears in SCOPe 2.07