Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (6 families) |
Family d.169.1.1: C-type lectin domain [56437] (26 proteins) Pfam 00059 |
Protein Mannose-binding protein A, C-lectin domain [56458] (2 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries) |
Domain d1kzb2_: 1kzb 2: [73347] complexed with ca, man |
PDB Entry: 1kzb (more details), 1.8 Å
SCOP Domain Sequences for d1kzb2_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kzb2_ d.169.1.1 (2:) Mannose-binding protein A, C-lectin domain {Rat (Rattus norvegicus)} kyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgitdqrtenvfe dltgnrvrytnwnegepnnvgsgencvvlltngkwndvpcsdsflvvcefs
Timeline for d1kzb2_: