Lineage for d1kza2_ (1kza 2:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 514330Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 514331Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 514332Family d.169.1.1: C-type lectin domain [56437] (24 proteins)
    Pfam 00059
  6. 514429Protein Mannose-binding protein A, lectin domain [56458] (2 species)
  7. 514432Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)
  8. 514440Domain d1kza2_: 1kza 2: [73345]

Details for d1kza2_

PDB Entry: 1kza (more details), 1.74 Å

PDB Description: complex of mbp-c and man-a13-man

SCOP Domain Sequences for d1kza2_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kza2_ d.169.1.1 (2:) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)}
kkyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgitdqrtenvf
edltgnrvrytnwnegepnnvgsgencvvlltngkwndvpcsdsflvvcefs

SCOP Domain Coordinates for d1kza2_:

Click to download the PDB-style file with coordinates for d1kza2_.
(The format of our PDB-style files is described here.)

Timeline for d1kza2_: