Lineage for d1kza1_ (1kza 1:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 336759Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 336760Superfamily d.169.1: C-type lectin-like [56436] (6 families) (S)
  5. 336761Family d.169.1.1: C-type lectin domain [56437] (21 proteins)
  6. 336839Protein Mannose-binding protein A, lectin domain [56458] (2 species)
  7. 336842Species Rat (Rattus norvegicus) [TaxId:10116] [56460] (38 PDB entries)
  8. 336855Domain d1kza1_: 1kza 1: [73344]

Details for d1kza1_

PDB Entry: 1kza (more details), 1.74 Å

PDB Description: complex of mbp-c and man-a13-man

SCOP Domain Sequences for d1kza1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kza1_ d.169.1.1 (1:) Mannose-binding protein A, lectin domain {Rat (Rattus norvegicus)}
nvgkkyfmssvrrmplnrakalcselqgtvatprnaeenraiqnvakdvaflgitdqrte
nvfedltgnrvrytnwnegepnnvgsgencvvlltngkwndvpcsdsflvvcefs

SCOP Domain Coordinates for d1kza1_:

Click to download the PDB-style file with coordinates for d1kza1_.
(The format of our PDB-style files is described here.)

Timeline for d1kza1_: