Lineage for d1kz9a_ (1kz9 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2462833Fold c.16: Lumazine synthase [52120] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2462834Superfamily c.16.1: Lumazine synthase [52121] (2 families) (S)
  5. 2462835Family c.16.1.1: Lumazine synthase [52122] (2 proteins)
  6. 2462836Protein Lumazine synthase [52123] (7 species)
  7. 2462926Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [75151] (7 PDB entries)
  8. 2462957Domain d1kz9a_: 1kz9 A: [73339]
    complexed with po4; mutant

Details for d1kz9a_

PDB Entry: 1kz9 (more details), 3.1 Å

PDB Description: mutant enzyme l119f lumazine synthase from s.pombe
PDB Compounds: (A:) 6,7-dimethyl-8-ribityllumazine synthase

SCOPe Domain Sequences for d1kz9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kz9a_ c.16.1.1 (A:) Lumazine synthase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
dlkgpelrilivharwnlqaieplvkgavetmiekhdvklenidiesvpgswelpqgira
siarntydavigigvlikgstmhfeyiseavvhglmrvgldsgvpvifglltvlneeqal
yraglngghnhgndwgsaavemglkal

SCOPe Domain Coordinates for d1kz9a_:

Click to download the PDB-style file with coordinates for d1kz9a_.
(The format of our PDB-style files is described here.)

Timeline for d1kz9a_: