SCOPe 2.07: Domain d1kz7c1: 1kz7 C:1624-1818

Lineage for d1kz7c1 (1kz7 C:1624-1818)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
   multihelical; core: 5-helical bundle

4. Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (2 families)
   automatically mapped to Pfam PF00621

5. Family a.87.1.1: DBL homology domain (DH-domain) [48066] (10 proteins)
   Pfam PF00621

6. Protein Dbl's big sister, Dbs [74743] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [74744] (4 PDB entries)
   Uniprot Q64096 624-958 # 98% sequence identity; the rat sequence Q63406 region 499-833 is 100% identical to the PDB sequence

8. Domain d1kz7c1: 1kz7 C:1624-1818 [73336]
   Other proteins in same PDB: d1kz7a2, d1kz7b_, d1kz7c2, d1kz7d_

Details for d1kz7c1

PDB Entry: 1kz7, 2.4 Å

PDB Description: crystal structure of the dh/ph fragment of murine dbs in complex with the placental isoform of human cdc42

PDB Compounds: (C:) guanine nucleotide exchange factor dbs

SCOPe Domain Sequences for d1kz7c1:

Sequence; same for both SEQRES and ATOM records:

>d1kz7c1 a.87.1.1 (C:1624-1818) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]}
eeeeslailrrhvmnelldterayveellcvlegyaaemdnplmahlistglqnkknilf
gnmeeiyhfhnriflrelescidcpelvgrcflermeefqiyekycqnkprseslwrqcs
dcpffqecqkkldhklsldsyllkpvqritkyqlllkemlkyskhcegaedlqealssil
gilkavndsmhliai

Timeline for d1kz7c1:

• d1kz7c1 first appeared in SCOP 1.61
  
• d1kz7c1 appears in SCOPe 2.06
  
• d1kz7c1 appears in the current release, SCOPe 2.08