SCOPe 2.01: Domain d1kz7b_: 1kz7 B:

Lineage for d1kz7b_ (1kz7 B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein CDC42 [52619] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52620] (24 PDB entries)

8. Domain d1kz7b_: 1kz7 B: [73335]
   Other proteins in same PDB: d1kz7a1, d1kz7a2, d1kz7c1, d1kz7c2

Details for d1kz7b_

PDB Entry: 1kz7, 2.4 Å

PDB Description: crystal structure of the dh/ph fragment of murine dbs in complex with the placental isoform of human cdc42

PDB Compounds: (B:) cdc42 homolog

SCOPe Domain Sequences for d1kz7b_:

Sequence; same for both SEQRES and ATOM records:

>d1kz7b_ c.37.1.8 (B:) CDC42 {Human (Homo sapiens) [TaxId: 9606]}
mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaalepp
epkksrrs

Timeline for d1kz7b_:

• d1kz7b_ first appeared in SCOP 1.61
  
• d1kz7b_ appears in SCOP 1.75
  
• d1kz7b_ appears in SCOPe 2.02
  
• d1kz7b_ appears in the current release, SCOPe 2.08