Lineage for d1kz7a1 (1kz7 A:624-818)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 154681Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
  4. 154682Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (1 family) (S)
  5. 154683Family a.87.1.1: DBL homology domain (DH-domain) [48066] (6 proteins)
  6. 154687Protein Dbl's big sister, Dbs [74743] (1 species)
  7. 154688Species Mouse (Mus musculus) [TaxId:10090] [74744] (3 PDB entries)
  8. 154689Domain d1kz7a1: 1kz7 A:624-818 [73333]
    Other proteins in same PDB: d1kz7a2, d1kz7b_, d1kz7c2, d1kz7d_

Details for d1kz7a1

PDB Entry: 1kz7 (more details), 2.4 Å

PDB Description: Crystal Structure of the DH/PH Fragment of Murine Dbs in Complex with the Placental Isoform of Human Cdc42

SCOP Domain Sequences for d1kz7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kz7a1 a.87.1.1 (A:624-818) Dbl's big sister, Dbs {Mouse (Mus musculus)}
eeeeslailrrhvmnelldterayveellcvlegyaaemdnplmahlistglqnkknilf
gnmeeiyhfhnriflrelescidcpelvgrcflermeefqiyekycqnkprseslwrqcs
dcpffqecqkkldhklsldsyllkpvqritkyqlllkemlkyskhcegaedlqealssil
gilkavndsmhliai

SCOP Domain Coordinates for d1kz7a1:

Click to download the PDB-style file with coordinates for d1kz7a1.
(The format of our PDB-style files is described here.)

Timeline for d1kz7a1: