Lineage for d1kz6d_ (1kz6 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2854558Fold c.16: Lumazine synthase [52120] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2854559Superfamily c.16.1: Lumazine synthase [52121] (2 families) (S)
  5. 2854560Family c.16.1.1: Lumazine synthase [52122] (2 proteins)
  6. 2854561Protein Lumazine synthase [52123] (7 species)
  7. 2854651Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [75151] (7 PDB entries)
  8. 2854675Domain d1kz6d_: 1kz6 D: [73331]
    complexed with po4; mutant

Details for d1kz6d_

PDB Entry: 1kz6 (more details), 2.7 Å

PDB Description: mutant enzyme w63y/l119f lumazine synthase from s.pombe
PDB Compounds: (D:) 6,7-dimethyl-8-ribityllumazine synthase

SCOPe Domain Sequences for d1kz6d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kz6d_ c.16.1.1 (D:) Lumazine synthase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
dlkgpelrilivharwnlqaieplvkgavetmiekhdvklenidiesvpgsyelpqgira
siarntydavigigvlikgstmhfeyiseavvhglmrvgldsgvpvifglltvlneeqal
yraglngghnhgndwgsaavemglkal

SCOPe Domain Coordinates for d1kz6d_:

Click to download the PDB-style file with coordinates for d1kz6d_.
(The format of our PDB-style files is described here.)

Timeline for d1kz6d_: