Lineage for d1kz4d_ (1kz4 D:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 177289Fold c.16: Lumazine synthase [52120] (1 superfamily)
  4. 177290Superfamily c.16.1: Lumazine synthase [52121] (1 family) (S)
  5. 177291Family c.16.1.1: Lumazine synthase [52122] (1 protein)
  6. 177292Protein Lumazine synthase [52123] (7 species)
  7. 177342Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [75151] (7 PDB entries)
  8. 177371Domain d1kz4d_: 1kz4 D: [73326]

Details for d1kz4d_

PDB Entry: 1kz4 (more details), 3.1 Å

PDB Description: mutant enzyme w63y lumazine synthase from s.pombe

SCOP Domain Sequences for d1kz4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kz4d_ c.16.1.1 (D:) Lumazine synthase {Fission yeast (Schizosaccharomyces pombe)}
dlkgpelrilivharwnlqaieplvkgavetmiekhdvklenidiesvpgsyelpqgira
siarntydavigigvlikgstmhfeyiseavvhglmrvgldsgvpvilglltvlneeqal
yraglngghnhgndwgsaavemglkal

SCOP Domain Coordinates for d1kz4d_:

Click to download the PDB-style file with coordinates for d1kz4d_.
(The format of our PDB-style files is described here.)

Timeline for d1kz4d_: