![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.16: Lumazine synthase [52120] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.16.1: Lumazine synthase [52121] (1 family) ![]() |
![]() | Family c.16.1.1: Lumazine synthase [52122] (1 protein) |
![]() | Protein Lumazine synthase [52123] (7 species) |
![]() | Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [75151] (7 PDB entries) |
![]() | Domain d1kz1e_: 1kz1 E: [73322] mutant |
PDB Entry: 1kz1 (more details), 2 Å
SCOP Domain Sequences for d1kz1e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kz1e_ c.16.1.1 (E:) Lumazine synthase {Fission yeast (Schizosaccharomyces pombe)} dlkgpelrilivhargnlqaieplvkgavetmiekhdvklenidiesvpgswelpqgira siarntydavigigvlikgstmhfeyiseavvhglmrvgldsgvpvilglltvlneeqal yraglngghnhgndwgsaavemglkal
Timeline for d1kz1e_:
![]() Domains from other chains: (mouse over for more information) d1kz1a_, d1kz1b_, d1kz1c_, d1kz1d_ |