Lineage for d1kz1d_ (1kz1 D:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 240739Fold c.16: Lumazine synthase [52120] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 240740Superfamily c.16.1: Lumazine synthase [52121] (1 family) (S)
  5. 240741Family c.16.1.1: Lumazine synthase [52122] (1 protein)
  6. 240742Protein Lumazine synthase [52123] (7 species)
  7. 240792Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [75151] (7 PDB entries)
  8. 240796Domain d1kz1d_: 1kz1 D: [73321]

Details for d1kz1d_

PDB Entry: 1kz1 (more details), 2 Å

PDB Description: mutant enzyme w27g lumazine synthase from s.pombe

SCOP Domain Sequences for d1kz1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kz1d_ c.16.1.1 (D:) Lumazine synthase {Fission yeast (Schizosaccharomyces pombe)}
npsdlkgpelrilivhargnlqaieplvkgavetmiekhdvklenidiesvpgswelpqg
irasiarntydavigigvlikgstmhfeyiseavvhglmrvgldsgvpvilglltvlnee
qalyraglngghnhgndwgsaavemglkal

SCOP Domain Coordinates for d1kz1d_:

Click to download the PDB-style file with coordinates for d1kz1d_.
(The format of our PDB-style files is described here.)

Timeline for d1kz1d_: