Lineage for d1kz1b_ (1kz1 B:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 177289Fold c.16: Lumazine synthase [52120] (1 superfamily)
  4. 177290Superfamily c.16.1: Lumazine synthase [52121] (1 family) (S)
  5. 177291Family c.16.1.1: Lumazine synthase [52122] (1 protein)
  6. 177292Protein Lumazine synthase [52123] (7 species)
  7. 177342Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [75151] (7 PDB entries)
  8. 177344Domain d1kz1b_: 1kz1 B: [73319]

Details for d1kz1b_

PDB Entry: 1kz1 (more details), 2 Å

PDB Description: mutant enzyme w27g lumazine synthase from s.pombe

SCOP Domain Sequences for d1kz1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kz1b_ c.16.1.1 (B:) Lumazine synthase {Fission yeast (Schizosaccharomyces pombe)}
sdlkgpelrilivhargnlqaieplvkgavetmiekhdvklenidiesvpgswelpqgir
asiarntydavigigvlikgstmhfeyiseavvhglmrvgldsgvpvilglltvlneeqa
lyraglngghnhgndwgsaavemglkal

SCOP Domain Coordinates for d1kz1b_:

Click to download the PDB-style file with coordinates for d1kz1b_.
(The format of our PDB-style files is described here.)

Timeline for d1kz1b_: