| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.16: Lumazine synthase [52120] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.16.1: Lumazine synthase [52121] (2 families) ![]() |
| Family c.16.1.1: Lumazine synthase [52122] (2 proteins) |
| Protein Lumazine synthase [52123] (7 species) |
| Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [75151] (7 PDB entries) |
| Domain d1kz1a_: 1kz1 A: [73318] mutant |
PDB Entry: 1kz1 (more details), 2 Å
SCOPe Domain Sequences for d1kz1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kz1a_ c.16.1.1 (A:) Lumazine synthase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
npsdlkgpelrilivhargnlqaieplvkgavetmiekhdvklenidiesvpgswelpqg
irasiarntydavigigvlikgstmhfeyiseavvhglmrvgldsgvpvilglltvlnee
qalyraglngghnhgndwgsaavemglkal
Timeline for d1kz1a_:
View in 3DDomains from other chains: (mouse over for more information) d1kz1b_, d1kz1c_, d1kz1d_, d1kz1e_ |