Lineage for d1kyza2 (1kyz A:120-362)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2129522Family c.66.1.12: Plant O-methyltransferase, C-terminal domain [64111] (6 protein domains)
    automatically mapped to Pfam PF00891
  6. 2129530Protein Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase [75259] (1 species)
  7. 2129531Species Alfalfa (Medicago sativa) [TaxId:3879] [75260] (2 PDB entries)
  8. 2129532Domain d1kyza2: 1kyz A:120-362 [73313]
    Other proteins in same PDB: d1kyza1, d1kyzc1, d1kyze1
    complexed with fer, sah

Details for d1kyza2

PDB Entry: 1kyz (more details), 2.2 Å

PDB Description: Crystal Structure Analysis of Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase Ferulic Acid Complex
PDB Compounds: (A:) Caffeic acid 3-O-methyltransferase

SCOPe Domain Sequences for d1kyza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]}
dgvsisalnlmnqdkvlmeswyhlkdavldggipfnkaygmtafeyhgtdprfnkvfnkg
msdhstitmkkiletytgfeglkslvdvgggtgavintivskyptikginfdlphvieda
psypgvehvggdmfvsipkadavfmkwichdwsdehclkflkncyealpdngkvivaeci
lpvapdsslatkgvvhidvimlahnpggkertqkefedlakgagfqgfkvhcnafntyim
efl

SCOPe Domain Coordinates for d1kyza2:

Click to download the PDB-style file with coordinates for d1kyza2.
(The format of our PDB-style files is described here.)

Timeline for d1kyza2: