Lineage for d1kyya_ (1kyy A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 177289Fold c.16: Lumazine synthase [52120] (1 superfamily)
  4. 177290Superfamily c.16.1: Lumazine synthase [52121] (1 family) (S)
  5. 177291Family c.16.1.1: Lumazine synthase [52122] (1 protein)
  6. 177292Protein Lumazine synthase [52123] (7 species)
  7. 177342Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [75151] (7 PDB entries)
  8. 177353Domain d1kyya_: 1kyy A: [73307]

Details for d1kyya_

PDB Entry: 1kyy (more details), 2.4 Å

PDB Description: Lumazine Synthase from S.pombe bound to nitropyrimidinedione

SCOP Domain Sequences for d1kyya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kyya_ c.16.1.1 (A:) Lumazine synthase {Fission yeast (Schizosaccharomyces pombe)}
psdlkgpelrilivharwnlqaieplvkgavetmiekhdvklenidiesvpgswelpqgi
rasiarntydavigigvlikgstmhfeyiseavvhglmrvgldsgvpvilglltvlneeq
alyraglngghnhgndwgsaavemglkal

SCOP Domain Coordinates for d1kyya_:

Click to download the PDB-style file with coordinates for d1kyya_.
(The format of our PDB-style files is described here.)

Timeline for d1kyya_: