Lineage for d1kywc1 (1kyw C:5-119)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1258750Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1259531Family a.4.5.29: Plant O-methyltransferase, N-terminal domain [63475] (5 proteins)
    unknown function
  6. 1259539Protein Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase [74686] (1 species)
  7. 1259540Species Alfalfa (Medicago sativa) [TaxId:3879] [74687] (2 PDB entries)
  8. 1259545Domain d1kywc1: 1kyw C:5-119 [73298]
    Other proteins in same PDB: d1kywa2, d1kywc2, d1kywf2
    complexed with hfl, sah

Details for d1kywc1

PDB Entry: 1kyw (more details), 2.4 Å

PDB Description: Crystal Structure Analysis of Caffeic Acid/5-hydroxyferulic acid 3/5-O-methyltransferase in complex with 5-hydroxyconiferaldehyde
PDB Compounds: (C:) Caffeic acid 3-O-methyltransferase

SCOPe Domain Sequences for d1kywc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kywc1 a.4.5.29 (C:5-119) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]}
getqitpthisdeeanlfamqlasasvlpmilksaleldlleiiakagpgaqispieias
qlpttnpdapvmldrmlrllacyiiltcsvrtqqdgkvqrlyglatvakylvkne

SCOPe Domain Coordinates for d1kywc1:

Click to download the PDB-style file with coordinates for d1kywc1.
(The format of our PDB-style files is described here.)

Timeline for d1kywc1: