SCOP 1.61: Domain d1kyve_: 1kyv E:

Lineage for d1kyve_ (1kyv E:)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.16: Lumazine synthase [52120] (1 superfamily)

4. Superfamily c.16.1: Lumazine synthase [52121] (1 family)

5. Family c.16.1.1: Lumazine synthase [52122] (1 protein)

6. Protein Lumazine synthase [52123] (7 species)

7. Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [75151] (7 PDB entries)

8. Domain d1kyve_: 1kyv E: [73295]

Details for d1kyve_

PDB Entry: 1kyv, 2.4 Å

PDB Description: Lumazine Synthase from S.pombe bound to riboflavin

SCOP Domain Sequences for d1kyve_:

Sequence; same for both SEQRES and ATOM records:

>d1kyve_ c.16.1.1 (E:) Lumazine synthase {Fission yeast (Schizosaccharomyces pombe)}
gpnpsdlkgpelrilivharwnlqaieplvkgavetmiekhdvklenidiesvpgswelp
qgirasiarntydavigigvlikgstmhfeyiseavvhglmrvgldsgvpvilglltvln
eeqalyraglngghnhgndwgsaavemglkal

Timeline for d1kyve_:

• d1kyve_ is new in SCOP 1.61
  
• d1kyve_ appears in SCOP 1.63
  
• d1kyve_ appears in the current release, SCOPe 2.08