SCOPe 2.05: Domain d1kyvd_: 1kyv D:

Lineage for d1kyvd_ (1kyv D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.16: Lumazine synthase [52120] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.16.1: Lumazine synthase [52121] (2 families)

5. Family c.16.1.1: Lumazine synthase [52122] (2 proteins)

6. Protein Lumazine synthase [52123] (7 species)

7. Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [75151] (7 PDB entries)

8. Domain d1kyvd_: 1kyv D: [73294]
   complexed with po4, rbf

Details for d1kyvd_

PDB Entry: 1kyv, 2.4 Å

PDB Description: Lumazine Synthase from S.pombe bound to riboflavin

PDB Compounds: (D:) 6,7-dimethyl-8-ribityllumazine synthase

SCOPe Domain Sequences for d1kyvd_:

Sequence; same for both SEQRES and ATOM records:

>d1kyvd_ c.16.1.1 (D:) Lumazine synthase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
dlkgpelrilivharwnlqaieplvkgavetmiekhdvklenidiesvpgswelpqgira
siarntydavigigvlikgstmhfeyiseavvhglmrvgldsgvpvilglltvlneeqal
yraglngghnhgndwgsaavemglkal

Timeline for d1kyvd_:

• d1kyvd_ first appeared in SCOP 1.61
  
• d1kyvd_ appears in SCOPe 2.04
  
• d1kyvd_ appears in SCOPe 2.06
  
• d1kyvd_ appears in the current release, SCOPe 2.08