Lineage for d1kyvc_ (1kyv C:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 177289Fold c.16: Lumazine synthase [52120] (1 superfamily)
  4. 177290Superfamily c.16.1: Lumazine synthase [52121] (1 family) (S)
  5. 177291Family c.16.1.1: Lumazine synthase [52122] (1 protein)
  6. 177292Protein Lumazine synthase [52123] (7 species)
  7. 177342Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [75151] (7 PDB entries)
  8. 177350Domain d1kyvc_: 1kyv C: [73293]

Details for d1kyvc_

PDB Entry: 1kyv (more details), 2.4 Å

PDB Description: Lumazine Synthase from S.pombe bound to riboflavin

SCOP Domain Sequences for d1kyvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kyvc_ c.16.1.1 (C:) Lumazine synthase {Fission yeast (Schizosaccharomyces pombe)}
sdlkgpelrilivharwnlqaieplvkgavetmiekhdvklenidiesvpgswelpqgir
asiarntydavigigvlikgstmhfeyiseavvhglmrvgldsgvpvilglltvlneeqa
lyraglngghnhgndwgsaavemglkaly

SCOP Domain Coordinates for d1kyvc_:

Click to download the PDB-style file with coordinates for d1kyvc_.
(The format of our PDB-style files is described here.)

Timeline for d1kyvc_: