Lineage for d1kyva_ (1kyv A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2113861Fold c.16: Lumazine synthase [52120] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2113862Superfamily c.16.1: Lumazine synthase [52121] (2 families) (S)
  5. 2113863Family c.16.1.1: Lumazine synthase [52122] (2 proteins)
  6. 2113864Protein Lumazine synthase [52123] (7 species)
  7. 2113954Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [75151] (7 PDB entries)
  8. 2113960Domain d1kyva_: 1kyv A: [73291]
    complexed with po4, rbf

Details for d1kyva_

PDB Entry: 1kyv (more details), 2.4 Å

PDB Description: Lumazine Synthase from S.pombe bound to riboflavin
PDB Compounds: (A:) 6,7-dimethyl-8-ribityllumazine synthase

SCOPe Domain Sequences for d1kyva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kyva_ c.16.1.1 (A:) Lumazine synthase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
dlkgpelrilivharwnlqaieplvkgavetmiekhdvklenidiesvpgswelpqgira
siarntydavigigvlikgstmhfeyiseavvhglmrvgldsgvpvilglltvlneeqal
yraglngghnhgndwgsaavemglkal

SCOPe Domain Coordinates for d1kyva_:

Click to download the PDB-style file with coordinates for d1kyva_.
(The format of our PDB-style files is described here.)

Timeline for d1kyva_: