| Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
| Fold c.16: Lumazine synthase [52120] (1 superfamily) |
Superfamily c.16.1: Lumazine synthase [52121] (1 family) ![]() |
| Family c.16.1.1: Lumazine synthase [52122] (1 protein) |
| Protein Lumazine synthase [52123] (7 species) |
| Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [75151] (7 PDB entries) |
| Domain d1kyva_: 1kyv A: [73291] |
PDB Entry: 1kyv (more details), 2.4 Å
SCOP Domain Sequences for d1kyva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kyva_ c.16.1.1 (A:) Lumazine synthase {Fission yeast (Schizosaccharomyces pombe)}
dlkgpelrilivharwnlqaieplvkgavetmiekhdvklenidiesvpgswelpqgira
siarntydavigigvlikgstmhfeyiseavvhglmrvgldsgvpvilglltvlneeqal
yraglngghnhgndwgsaavemglkal
Timeline for d1kyva_:
View in 3DDomains from other chains: (mouse over for more information) d1kyvb_, d1kyvc_, d1kyvd_, d1kyve_ |