![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.105: Subdomain of clathrin and coatomer appendage domain [55710] (1 superfamily) beta-alpha-beta-alpha-beta(4)-alpha; 3 layers: a/b/a; bifurcated antiparallel beta-sheet |
![]() | Superfamily d.105.1: Subdomain of clathrin and coatomer appendage domain [55711] (2 families) ![]() |
![]() | Family d.105.1.1: Clathrin adaptor appendage, alpha and beta chain-specific domain [55712] (2 proteins) |
![]() | Protein Alpa-adaptin AP2, C-terminal subdomain [55713] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [55714] (9 PDB entries) |
![]() | Domain d1kyua2: 1kyu A:825-938 [73290] Other proteins in same PDB: d1kyua1 |
PDB Entry: 1kyu (more details), 1.8 Å
SCOP Domain Sequences for d1kyua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kyua2 d.105.1.1 (A:825-938) Alpa-adaptin AP2, C-terminal subdomain {Mouse (Mus musculus)} ffqptemasqdffqrwkqlsnpqqevqnifkakhpmdteitkakiigfgsalleevdpnp anfvgagiihtkttqigcllrlepnlqaqmyrltlrtskdtvsqrlcellseqf
Timeline for d1kyua2: