Lineage for d1kyua2 (1kyu A:825-938)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 609024Fold d.105: Subdomain of clathrin and coatomer appendage domain [55710] (1 superfamily)
    beta-alpha-beta-alpha-beta(4)-alpha; 3 layers: a/b/a; bifurcated antiparallel beta-sheet
  4. 609025Superfamily d.105.1: Subdomain of clathrin and coatomer appendage domain [55711] (2 families) (S)
  5. 609026Family d.105.1.1: Clathrin adaptor appendage, alpha and beta chain-specific domain [55712] (2 proteins)
  6. 609027Protein Alpa-adaptin AP2, C-terminal subdomain [55713] (1 species)
  7. 609028Species Mouse (Mus musculus) [TaxId:10090] [55714] (9 PDB entries)
  8. 609033Domain d1kyua2: 1kyu A:825-938 [73290]
    Other proteins in same PDB: d1kyua1

Details for d1kyua2

PDB Entry: 1kyu (more details), 1.8 Å

PDB Description: ap-2 clathrin adaptor alpha-appendage in complex with eps15 dpf peptide

SCOP Domain Sequences for d1kyua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kyua2 d.105.1.1 (A:825-938) Alpa-adaptin AP2, C-terminal subdomain {Mouse (Mus musculus)}
ffqptemasqdffqrwkqlsnpqqevqnifkakhpmdteitkakiigfgsalleevdpnp
anfvgagiihtkttqigcllrlepnlqaqmyrltlrtskdtvsqrlcellseqf

SCOP Domain Coordinates for d1kyua2:

Click to download the PDB-style file with coordinates for d1kyua2.
(The format of our PDB-style files is described here.)

Timeline for d1kyua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kyua1