![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (3 families) ![]() contains an additional N-terminal strand |
![]() | Family b.1.10.1: Alpha-adaptin ear subdomain-like [49349] (2 proteins) ear domain consists of two different subdomains |
![]() | Protein Alpha-adaptin AP2 ear domain, N-terminal subdomain [49350] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [49351] (9 PDB entries) |
![]() | Domain d1kyua1: 1kyu A:692-824 [73289] Other proteins in same PDB: d1kyua2 complexed with eps15 dpf peptide (chain P) |
PDB Entry: 1kyu (more details), 1.8 Å
SCOP Domain Sequences for d1kyua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kyua1 b.1.10.1 (A:692-824) Alpha-adaptin AP2 ear domain, N-terminal subdomain {Mouse (Mus musculus)} gspgirlgssednfarfvcknngvlfenqllqiglksefrqnlgrmfifygnktstqfln ftptlicaddlqtnlnlqtkpvdptvdggaqvqqvvniecisdfteapvlniqfryggtf qnvsvklpitlnk
Timeline for d1kyua1: