Lineage for d1kyqc1 (1kyq C:1-150)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830485Family c.2.1.11: Siroheme synthase N-terminal domain-like [75110] (2 proteins)
  6. 1830486Protein Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain [75111] (1 species)
    involved in siroheme synthesis
  7. 1830487Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [75112] (1 PDB entry)
  8. 1830490Domain d1kyqc1: 1kyq C:1-150 [73285]
    Other proteins in same PDB: d1kyqa2, d1kyqb2, d1kyqc2
    complexed with nad

Details for d1kyqc1

PDB Entry: 1kyq (more details), 2.2 Å

PDB Description: Met8p: A bifunctional NAD-dependent dehydrogenase and ferrochelatase involved in siroheme synthesis.
PDB Compounds: (C:) Siroheme biosynthesis protein MET8

SCOPe Domain Sequences for d1kyqc1:

Sequence, based on SEQRES records: (download)

>d1kyqc1 c.2.1.11 (C:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mvkslqlahqlkdkrilligggevgltrlyklmptgckltlvspdlhksiipkfgkfiqn
kdqpdyredakrfinpnwdptkneiyeyirsdfkdeyldlenendawyiimtcipdhpes
ariyhlckerfgkqqlvnvadkpdlcdfyf

Sequence, based on observed residues (ATOM records): (download)

>d1kyqc1 c.2.1.11 (C:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mvkslqlahqlkdkrilligggevgltrlyklmptgckltlvspdlhksiipkfgkfiqk
rfinpnwdptkneiyeyirsdfkdeyldlenendawyiimtcipdhpesariyhlckerf
gkqqlvnvadkpdlcdfyf

SCOPe Domain Coordinates for d1kyqc1:

Click to download the PDB-style file with coordinates for d1kyqc1.
(The format of our PDB-style files is described here.)

Timeline for d1kyqc1: