![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species) VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species |
![]() | Species Mouse (Mus musculus), cluster 7.1 [TaxId:10090] [88557] (39 PDB entries) Uniprot P18532 # HV61_MOUSE Ig heavy chain V region 1B43 precursor |
![]() | Domain d1kyou_: 1kyo U: [73277] Other proteins in same PDB: d1kyoa1, d1kyoa2, d1kyob1, d1kyob2, d1kyoc2, d1kyoc3, d1kyod1, d1kyod2, d1kyoe1, d1kyoe2, d1kyof_, d1kyog_, d1kyoh_, d1kyoi_, d1kyok_, d1kyol1, d1kyol2, d1kyom1, d1kyom2, d1kyon2, d1kyon3, d1kyoo1, d1kyoo2, d1kyop1, d1kyop2, d1kyoq_, d1kyor_, d1kyos_, d1kyot_, d1kyov_, d1kyow_ part of Fv against Rieske protein from the yeast cytochrome bc1 complex complexed with fes, hem, sma |
PDB Entry: 1kyo (more details), 2.97 Å
SCOPe Domain Sequences for d1kyou_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kyou_ b.1.1.1 (U:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]} evklqesgaglvqpsqslsltcsvtgysitsgyywnwirlfpgnklewvgyisnvgdnny npslkdrlsitrdtsknqfflklnsvttedtatyycarseyysvtgyamdywgqgttvtv ssawrhp
Timeline for d1kyou_:
![]() Domains from other chains: (mouse over for more information) d1kyoa1, d1kyoa2, d1kyob1, d1kyob2, d1kyoc2, d1kyoc3, d1kyod1, d1kyod2, d1kyoe1, d1kyoe2, d1kyof_, d1kyog_, d1kyoh_, d1kyoi_, d1kyoj_, d1kyok_, d1kyol1, d1kyol2, d1kyom1, d1kyom2, d1kyon2, d1kyon3, d1kyoo1, d1kyoo2, d1kyop1, d1kyop2, d1kyoq_, d1kyor_, d1kyos_, d1kyot_, d1kyov_, d1kyow_ |