Details for d1kyot_

PDB Entry: 1kyo (more details), 2.97 Å

PDB Description: yeast cytochrome bc1 complex with bound substrate cytochrome c
PDB Compounds: (T:) ubiquinol-cytochrome c reductase complex 7.3 kd protein

SCOP Domain Sequences for d1kyot_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kyot_ f.23.14.1 (T:) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sslyktffkrnavfvgtifagafvfqtvfdtaitswyenhnkgklwkdvkaki

SCOP Domain Coordinates for d1kyot_:

Click to download the PDB-style file with coordinates for d1kyot_.
(The format of our PDB-style files is described here.)

Timeline for d1kyot_: