Lineage for d1kyoq_ (1kyo Q:)

  1. Root: SCOP 1.63
  2. 267451Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)
  3. 268492Fold f.28: Nonheme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 268493Superfamily f.28.1: Nonheme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) (S)
    location - intermembrane side of the bc1 complex
  5. 268494Family f.28.1.1: Nonheme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (1 protein)
    "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1
  6. 268495Protein Nonheme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81529] (3 species)
  7. 268496Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81528] (3 PDB entries)
  8. 268500Domain d1kyoq_: 1kyo Q: [73273]
    Other proteins in same PDB: d1kyoa1, d1kyoa2, d1kyob1, d1kyob2, d1kyoc2, d1kyoc3, d1kyod1, d1kyod2, d1kyoe1, d1kyoe2, d1kyog_, d1kyoh_, d1kyoi_, d1kyoj_, d1kyok_, d1kyol1, d1kyol2, d1kyom1, d1kyom2, d1kyon2, d1kyon3, d1kyoo1, d1kyoo2, d1kyop1, d1kyop2, d1kyor_, d1kyos_, d1kyot_, d1kyou_, d1kyov_, d1kyow_
    complexed with fes, hem, m3l, sma

Details for d1kyoq_

PDB Entry: 1kyo (more details), 2.97 Å

PDB Description: yeast cytochrome bc1 complex with bound substrate cytochrome c

SCOP Domain Sequences for d1kyoq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kyoq_ f.28.1.1 (Q:) Nonheme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Baker's yeast (Saccharomyces cerevisiae)}
dtdqledlrehfknteegkalvhhyeecaervkiqqqqpgyadlehkedcveeffhlqhy
ldtataprlfdklk

SCOP Domain Coordinates for d1kyoq_:

Click to download the PDB-style file with coordinates for d1kyoq_.
(The format of our PDB-style files is described here.)

Timeline for d1kyoq_: