Lineage for d1kyop1 (1kyo P:87-215)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 165342Fold b.33: ISP domain [50021] (1 superfamily)
  4. 165343Superfamily b.33.1: ISP domain [50022] (2 families) (S)
  5. 165344Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (5 proteins)
  6. 165356Protein ISP subunit of the mitochondrial cytochrome bc1-complex, watersoluble domain [50024] (3 species)
  7. 165357Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63741] (2 PDB entries)
  8. 165360Domain d1kyop1: 1kyo P:87-215 [73271]
    Other proteins in same PDB: d1kyoa1, d1kyoa2, d1kyob1, d1kyob2, d1kyoc1, d1kyod1, d1kyod2, d1kyoe2, d1kyof1, d1kyog1, d1kyoh1, d1kyoi1, d1kyoj_, d1kyok_, d1kyol1, d1kyol2, d1kyom1, d1kyom2, d1kyon1, d1kyoo1, d1kyoo2, d1kyop2, d1kyoq1, d1kyor1, d1kyos1, d1kyot1, d1kyou_, d1kyov_, d1kyow_

Details for d1kyop1

PDB Entry: 1kyo (more details), 2.97 Å

PDB Description: yeast cytochrome bc1 complex with bound substrate cytochrome c
PDB Compounds: (P:)

SCOP Domain Sequences for d1kyop1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kyop1 b.33.1.1 (P:87-215) ISP subunit of the mitochondrial cytochrome bc1-complex, watersoluble domain {Baker's yeast (Saccharomyces cerevisiae)}
dvlamakvevnlaaiplgknvvvkwqgkpvfirhrtpheiqeansvdmsalkdpqtdadr
vkdpqwlimlgicthlgcvpigeagdfggwfcpchgshydisgrirkgpaplnleipaye
fdgdkvivg

SCOP Domain Coordinates for d1kyop1:

Click to download the PDB-style file with coordinates for d1kyop1.
(The format of our PDB-style files is described here.)

Timeline for d1kyop1: