Details for d1kyoo2

PDB Entry: 1kyo (more details), 2.97 Å

PDB Description: yeast cytochrome bc1 complex with bound substrate cytochrome c
PDB Compounds: (O:) cytochrome c1, heme protein

SCOPe Domain Sequences for d1kyoo2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kyoo2 f.23.11.1 (O:261-306) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pehderkrlglktviilsslyllsiwvkkfkwagiktrkfvfnppk

SCOPe Domain Coordinates for d1kyoo2:

Click to download the PDB-style file with coordinates for d1kyoo2.
(The format of our PDB-style files is described here.)

Timeline for d1kyoo2: