Lineage for d1kyoo1 (1kyo O:62-260)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 209874Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 209875Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 210172Family a.3.1.3: Cytochrome bc1 domain [46676] (1 protein)
  6. 210173Protein Cytochrome bc1 domain [46677] (3 species)
  7. 210174Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63462] (3 PDB entries)
  8. 210178Domain d1kyoo1: 1kyo O:62-260 [73269]
    Other proteins in same PDB: d1kyoa1, d1kyoa2, d1kyob1, d1kyob2, d1kyoc2, d1kyoc3, d1kyod2, d1kyoe1, d1kyoe2, d1kyof_, d1kyog_, d1kyoh_, d1kyoi_, d1kyoj_, d1kyok_, d1kyol1, d1kyol2, d1kyom1, d1kyom2, d1kyon2, d1kyon3, d1kyoo2, d1kyop1, d1kyop2, d1kyoq_, d1kyor_, d1kyos_, d1kyot_, d1kyou_, d1kyov_, d1kyow_
    complexed with fes, hem, m3l, sma

Details for d1kyoo1

PDB Entry: 1kyo (more details), 2.97 Å

PDB Description: yeast cytochrome bc1 complex with bound substrate cytochrome c
PDB Compounds: (O:)

SCOP Domain Sequences for d1kyoo1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kyoo1 a.3.1.3 (O:62-260) Cytochrome bc1 domain {Baker's yeast (Saccharomyces cerevisiae)}
mtaaehglhapayawshngpfetfdhasirrgyqvyrevcaachsldrvawrtlvgvsht
neevrnmaeefeyddepdeqgnpkkrpgklsdyipgpypneqaaraanqgalppdlsliv
karhggcdyifslltgypdeppagvalppgsnynpyfpggsiamarvlfddmveyedgtp
attsqmakdvttflnwcae

SCOP Domain Coordinates for d1kyoo1:

Click to download the PDB-style file with coordinates for d1kyoo1.
(The format of our PDB-style files is described here.)

Timeline for d1kyoo1: