| Class b: All beta proteins [48724] (111 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
| Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species) |
| Species Fv against Rieske protein from the yeast cytochrome bc1 complex, (mouse), kappa L chain [63641] (2 PDB entries) |
| Domain d1kyok_: 1kyo K: [73263] Other proteins in same PDB: d1kyoa1, d1kyoa2, d1kyob1, d1kyob2, d1kyoc1, d1kyod1, d1kyod2, d1kyoe1, d1kyoe2, d1kyof1, d1kyog1, d1kyoh1, d1kyoi1, d1kyol1, d1kyol2, d1kyom1, d1kyom2, d1kyon1, d1kyoo1, d1kyoo2, d1kyop1, d1kyop2, d1kyoq1, d1kyor1, d1kyos1, d1kyot1, d1kyow_ |
PDB Entry: 1kyo (more details), 2.97 Å
SCOP Domain Sequences for d1kyok_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kyok_ b.1.1.1 (K:) Immunoglobulin (variable domains of L and H chains) {Fv against Rieske protein from the yeast cytochrome bc1 complex, (mouse), kappa L chain}
dieltqtpvslaaslgdrvtiscrasqdinnflnwyqqkpdgtiklliyytsrlhagvps
rfsgsgsgtdysltisnlepediatyfcqhhikfpwtfgagtkleik
Timeline for d1kyok_:
View in 3DDomains from other chains: (mouse over for more information) d1kyoa1, d1kyoa2, d1kyob1, d1kyob2, d1kyoc1, d1kyod1, d1kyod2, d1kyoe1, d1kyoe2, d1kyof1, d1kyog1, d1kyoh1, d1kyoi1, d1kyoj_, d1kyol1, d1kyol2, d1kyom1, d1kyom2, d1kyon1, d1kyoo1, d1kyoo2, d1kyop1, d1kyop2, d1kyoq1, d1kyor1, d1kyos1, d1kyot1, d1kyou_, d1kyov_, d1kyow_ |