SCOP 1.71: Domain d1kyoj_: 1kyo J:

Lineage for d1kyoj_ (1kyo J:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 7.1 [TaxId:10090] [88557] (34 PDB entries)

8. Domain d1kyoj_: 1kyo J: [73262]
   Other proteins in same PDB: d1kyoa1, d1kyoa2, d1kyob1, d1kyob2, d1kyoc2, d1kyoc3, d1kyod1, d1kyod2, d1kyoe1, d1kyoe2, d1kyof_, d1kyog_, d1kyoh_, d1kyoi_, d1kyok_, d1kyol1, d1kyol2, d1kyom1, d1kyom2, d1kyon2, d1kyon3, d1kyoo1, d1kyoo2, d1kyop1, d1kyop2, d1kyoq_, d1kyor_, d1kyos_, d1kyot_, d1kyov_, d1kyow_

Details for d1kyoj_

PDB Entry: 1kyo, 2.97 Å

PDB Description: yeast cytochrome bc1 complex with bound substrate cytochrome c

SCOP Domain Sequences for d1kyoj_:

Sequence; same for both SEQRES and ATOM records:

>d1kyoj_ b.1.1.1 (J:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1}
evklqesgaglvqpsqslsltcsvtgysitsgyywnwirlfpgnklewvgyisnvgdnny
npslkdrlsitrdtsknqfflklnsvttedtatyycarseyysvtgyamdywgqgttvtv
ssawrhp

Timeline for d1kyoj_:

• d1kyoj_ first appeared in SCOP 1.61
  
• d1kyoj_ appears in SCOP 1.69
  
• d1kyoj_ appears in SCOP 1.73
  
• d1kyoj_ appears in the current release, SCOPe 2.08