Details for d1kyoi_

PDB Entry: 1kyo (more details), 2.97 Å

PDB Description: yeast cytochrome bc1 complex with bound substrate cytochrome c

SCOP Domain Sequences for d1kyoi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kyoi_ f.23.14.1 (I:) Subunit X (nonheme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Baker's yeast (Saccharomyces cerevisiae)}
sslyktffkrnavfvgtifagafvfqtvfdtaitswyenhnkgklwkdvkaki

SCOP Domain Coordinates for d1kyoi_:

Click to download the PDB-style file with coordinates for d1kyoi_.
(The format of our PDB-style files is described here.)

Timeline for d1kyoi_: