SCOPe 2.07: Domain d1kyoh_: 1kyo H:

Lineage for d1kyoh_ (1kyo H:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family)
   automatically mapped to Pfam PF02939

5. Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (2 proteins)

6. Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species)
   together with cytochrome b binds to ubiquinone

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81505] (10 PDB entries)

8. Domain d1kyoh_: 1kyo H: [73260]
   Other proteins in same PDB: d1kyoa1, d1kyoa2, d1kyob1, d1kyob2, d1kyoc2, d1kyoc3, d1kyod1, d1kyod2, d1kyoe1, d1kyoe2, d1kyof_, d1kyog_, d1kyoi_, d1kyoj_, d1kyok_, d1kyol1, d1kyol2, d1kyom1, d1kyom2, d1kyon2, d1kyon3, d1kyoo1, d1kyoo2, d1kyop1, d1kyop2, d1kyoq_, d1kyor_, d1kyot_, d1kyou_, d1kyov_, d1kyow_
   complexed with fes, hem, sma

Details for d1kyoh_

PDB Entry: 1kyo, 2.97 Å

PDB Description: yeast cytochrome bc1 complex with bound substrate cytochrome c

PDB Compounds: (H:) ubiquinol-cytochrome c reductase complex ubiquinone-binding protein qp-c

SCOPe Domain Sequences for d1kyoh_:

Sequence; same for both SEQRES and ATOM records:

>d1kyoh_ f.23.13.1 (H:) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gppsgktymgwwghmggpkqkgitsyavspyaqkplqgifhnavfnsfrrfksqflyvli
pagiywywwkngneyneflyskagreelervnv

Timeline for d1kyoh_:

• d1kyoh_ first appeared in SCOP 1.61, called d1kyoh1
  
• d1kyoh_ appears in SCOPe 2.06
  
• d1kyoh_ appears in the current release, SCOPe 2.08