| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) ![]() Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
| Family d.185.1.1: MPP-like [63412] (7 proteins) Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal |
| Protein Cytochrome bc1 core subunit 1 [63408] (3 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64304] (7 PDB entries) |
| Domain d1kyoa2: 1kyo A:240-456 [73250] Other proteins in same PDB: d1kyob1, d1kyob2, d1kyoc2, d1kyoc3, d1kyod1, d1kyod2, d1kyoe1, d1kyoe2, d1kyof_, d1kyog_, d1kyoh_, d1kyoi_, d1kyoj_, d1kyok_, d1kyom1, d1kyom2, d1kyon2, d1kyon3, d1kyoo1, d1kyoo2, d1kyop1, d1kyop2, d1kyoq_, d1kyor_, d1kyos_, d1kyot_, d1kyou_, d1kyov_, d1kyow_ complexed with fes, hem, sma |
PDB Entry: 1kyo (more details), 2.97 Å
SCOPe Domain Sequences for d1kyoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kyoa2 d.185.1.1 (A:240-456) Cytochrome bc1 core subunit 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kaaflgsevrlrddtlpkawislavegepvnspnyfvaklaaqifgsynafepasrlqgi
klldniqeyqlcdnfnhfslsykdsglwgfstatrnvtmiddlihftlkqwnrltisvtd
teveraksllklqlgqlyesgnpvndanllgaevlikgsklslgeafkkidaitvkdvka
wagkrlwdqdiaiagtgqieglldymrirsdmsmmrw
Timeline for d1kyoa2:
View in 3DDomains from other chains: (mouse over for more information) d1kyob1, d1kyob2, d1kyoc2, d1kyoc3, d1kyod1, d1kyod2, d1kyoe1, d1kyoe2, d1kyof_, d1kyog_, d1kyoh_, d1kyoi_, d1kyoj_, d1kyok_, d1kyol1, d1kyol2, d1kyom1, d1kyom2, d1kyon2, d1kyon3, d1kyoo1, d1kyoo2, d1kyop1, d1kyop2, d1kyoq_, d1kyor_, d1kyos_, d1kyot_, d1kyou_, d1kyov_, d1kyow_ |