SCOPe 2.05: Domain d1kynb_: 1kyn B:

Lineage for d1kynb_ (1kyn B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Cathepsin G [50548] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50549] (3 PDB entries)

8. Domain d1kynb_: 1kyn B: [73248]
   complexed with ktp

Details for d1kynb_

PDB Entry: 1kyn, 3.5 Å

PDB Description: Cathepsin-G

PDB Compounds: (B:) cathepsin G

SCOPe Domain Sequences for d1kynb_:

Sequence; same for both SEQRES and ATOM records:

>d1kynb_ b.47.1.2 (B:) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]}
iiggresrphsrpymaylqiqspagqsrcggflvredfvltaahcwgsninvtlgahniq
rrentqqhitarrairhpqynqrtiqndimllqlsrrvrrnrnvnpvalpraqeglrpgt
lctvagwgrvsmrrgtdtlrevqlrvqrdrqclrifgsydprrqicvgdrrerkaafkgd
sggpllcnnvahgivsygkssgvppevftrvssflpwirttmrsf

Timeline for d1kynb_:

• d1kynb_ first appeared in SCOP 1.61
  
• d1kynb_ appears in SCOPe 2.04
  
• d1kynb_ appears in SCOPe 2.06
  
• d1kynb_ appears in the current release, SCOPe 2.08