Lineage for d1kynb_ (1kyn B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2056061Protein Cathepsin G [50548] (1 species)
  7. 2056062Species Human (Homo sapiens) [TaxId:9606] [50549] (3 PDB entries)
  8. 2056066Domain d1kynb_: 1kyn B: [73248]
    complexed with ktp

Details for d1kynb_

PDB Entry: 1kyn (more details), 3.5 Å

PDB Description: Cathepsin-G
PDB Compounds: (B:) cathepsin G

SCOPe Domain Sequences for d1kynb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kynb_ b.47.1.2 (B:) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]}
iiggresrphsrpymaylqiqspagqsrcggflvredfvltaahcwgsninvtlgahniq
rrentqqhitarrairhpqynqrtiqndimllqlsrrvrrnrnvnpvalpraqeglrpgt
lctvagwgrvsmrrgtdtlrevqlrvqrdrqclrifgsydprrqicvgdrrerkaafkgd
sggpllcnnvahgivsygkssgvppevftrvssflpwirttmrsf

SCOPe Domain Coordinates for d1kynb_:

Click to download the PDB-style file with coordinates for d1kynb_.
(The format of our PDB-style files is described here.)

Timeline for d1kynb_: