Lineage for d1kyna_ (1kyn A:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (38 proteins) 
Protein Cathepsin G [50548] (1 species) Species Human (Homo sapiens) [TaxId:9606] [50549] (3 PDB entries) 
Domain d1kyna_: 1kyn A: [73247]
Details for d1kyna_
PDB Entry: 1kyn (more details), 3.5 Å
PDB Description: Cathepsin-G
SCOP Domain Sequences for d1kyna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kyna_ b.47.1.2 (A:) Cathepsin G {Human (Homo sapiens)}
iiggresrphsrpymaylqiqspagqsrcggflvredfvltaahcwgsninvtlgahniq
rrentqqhitarrairhpqynqrtiqndimllqlsrrvrrnrnvnpvalpraqeglrpgt
lctvagwgrvsmrrgtdtlrevqlrvqrdrqclrifgsydprrqicvgdrrerkaafkgd
sggpllcnnvahgivsygkssgvppevftrvssflpwirttmr
SCOP Domain Coordinates for d1kyna_:
Click to download the PDB-style file with coordinates for d1kyna_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kyna_:
- d1kyna_ is new in SCOP 1.61
- d1kyna_ appears in SCOP 1.63
- d1kyna_ appears in the current release, SCOPe 2.08
View in 3D
